PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21410_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 165aa    MW: 19447.5 Da    PI: 10.377
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21410_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.81e-26959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRr+g+lKK +ELSvLCda++ +iifsstgkl  y++
  Neem_21410_f_1  9 KRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCT 59
                    79***********************************************96 PP

2K-box62.51.7e-21831591288
           K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                        e+l +el  L+ke++ Lq + R++ Ge+L+s+ +++L +Leq+Le+s++k+R +Knell +q+++l++ke++l+
  Neem_21410_f_1  83 DSREQLLNELGVLRKETRHLQLSMRRYTGENLSSIPYEDLDELEQELERSVNKVRGRKNELLQQQLDNLRRKERMLD 159
                     45678999******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.857161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-29279IPR002100Transcription factor, MADS-box
CDDcd002651.94E-36276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014868.1E-2081159IPR002487Transcription factor, K-box
PROSITE profilePS5129712.71285165IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGRGKIAIKR IENPTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFSS TGKLCQYCTE  60
PYRIEQIIKR RTKVTGIRIP EHDSREQLLN ELGVLRKETR HLQLSMRRYT GENLSSIPYE  120
DLDELEQELE RSVNKVRGRK NELLQQQLDN LRRKERMLDS LMWIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A1e-17259158MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B1e-17259158MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
3kov_A2e-17259158Myocyte-specific enhancer factor 2A
3kov_B2e-17259158Myocyte-specific enhancer factor 2A
3kov_I2e-17259158Myocyte-specific enhancer factor 2A
3kov_J2e-17259158Myocyte-specific enhancer factor 2A
3p57_A2e-17259158Myocyte-specific enhancer factor 2A
3p57_B2e-17259158Myocyte-specific enhancer factor 2A
3p57_C2e-17259158Myocyte-specific enhancer factor 2A
3p57_D2e-17259158Myocyte-specific enhancer factor 2A
3p57_I2e-17259158Myocyte-specific enhancer factor 2A
3p57_J2e-17259158Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437607.11e-99hypothetical protein CICLE_v10032489mg
SwissprotQ9ATE52e-68FBP24_PETHY; MADS-box protein FBP24
TrEMBLV4TC411e-99V4TC41_9R
STRINGPOPTR_0007s07620.14e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65062543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-57MIKC_MADS family protein